(data stored in SCRATCH zone)

EMBL: CP001778.PE572

CP001778.PE572       Location/Qualifiers
FT   CDS             611360..612232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0581"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce9074 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40295"
FT                   /db_xref="GOA:D3Q5Z6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Z6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD40295.1"
FT                   /translation="MLEIRNLRKRFGEKTALDDVSLTVEPGQVFGFVGANGAGKTTTMR
FT                   IAMGVLIADSGDVLWDGEPMGHAQRLRTGYMPEERGLYPKMKIGEQLAYFAELHGETPG
FT                   GSKKAAATWLERLGLSDRSGDFVQDLSLGNQQRVQLAVSLVHDPKLLILDEPFSGLDPI
FT                   AVDTMATVLSERSAAGVPVIFSSHQLDLVERLSDSVGIIAAGNIVASGSVDDLRRRGNR
FT                   KLRVSIDGAAPTWADALPGEVANVDEGEWVIDSGDDQKVLAAAMAAGRVTRFGFDEPSL
FT                   VDIFRETVS"
     MLEIRNLRKR FGEKTALDDV SLTVEPGQVF GFVGANGAGK TTTMRIAMGV LIADSGDVLW        60
     DGEPMGHAQR LRTGYMPEER GLYPKMKIGE QLAYFAELHG ETPGGSKKAA ATWLERLGLS       120
     DRSGDFVQDL SLGNQQRVQL AVSLVHDPKL LILDEPFSGL DPIAVDTMAT VLSERSAAGV       180
     PVIFSSHQLD LVERLSDSVG IIAAGNIVAS GSVDDLRRRG NRKLRVSIDG AAPTWADALP       240
     GEVANVDEGE WVIDSGDDQK VLAAAMAAGR VTRFGFDEPS LVDIFRETVS                  290
//

If you have problems or comments...

PBIL Back to PBIL home page