(data stored in SCRATCH zone)

EMBL: CP001778.PE579

CP001778.PE579       Location/Qualifiers
FT   CDS             620054..620491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40302"
FT                   /db_xref="GOA:D3Q603"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q603"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40302.1"
FT                   /translation="MSAKQAKQPSFPQRDDNGRIVLLTQLLGFIAMSVALGVVMLAVID
FT                   GLLALLGFTEFGKDISGWICGVLAVFVFVDEFRAYKGQSVRYWLAPVAGLLALAFGIVI
FT                   SAVLPTGWLPLFTGAIGVAAAMLAYGALWFVGTRLTGADIS"
     MSAKQAKQPS FPQRDDNGRI VLLTQLLGFI AMSVALGVVM LAVIDGLLAL LGFTEFGKDI        60
     SGWICGVLAV FVFVDEFRAY KGQSVRYWLA PVAGLLALAF GIVISAVLPT GWLPLFTGAI       120
     GVAAAMLAYG ALWFVGTRLT GADIS                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page