(data stored in SCRATCH zone)

EMBL: CP001778.PE585

CP001778.PE585       Location/Qualifiers
FT   CDS             623873..624763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0594"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mno:Mnod_8081
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40308"
FT                   /db_xref="GOA:D3Q609"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q609"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADD40308.1"
FT                   /translation="MKKRSLIATAGVLAAGGAAALAYASLIERFRFQLRRFDVPVLAPD
FT                   TEPLRILHISDLHLSPNSHKEVEWVASLAALDPDLVVLTGDNLAHPEAVSTVSAALEPL
FT                   FTYPGVFVFGSNDYYAPVLKNPFTYFNPNREHKYGEELPTEELRKMLTGAGWRDLNNAT
FT                   TTIPIADRTIAVAGVDDPHFDLDDYDLIAGEAPTDASVTLGLTHSPEPRVLDQMAADGY
FT                   QLLLAGHTHGGQVCVPGYGALVTNCGIDRKRVKGLHRYGSSWLHVSAGLGTSPYAPIRF
FT                   ACHPEASILTLIPRT"
     MKKRSLIATA GVLAAGGAAA LAYASLIERF RFQLRRFDVP VLAPDTEPLR ILHISDLHLS        60
     PNSHKEVEWV ASLAALDPDL VVLTGDNLAH PEAVSTVSAA LEPLFTYPGV FVFGSNDYYA       120
     PVLKNPFTYF NPNREHKYGE ELPTEELRKM LTGAGWRDLN NATTTIPIAD RTIAVAGVDD       180
     PHFDLDDYDL IAGEAPTDAS VTLGLTHSPE PRVLDQMAAD GYQLLLAGHT HGGQVCVPGY       240
     GALVTNCGID RKRVKGLHRY GSSWLHVSAG LGTSPYAPIR FACHPEASIL TLIPRT           296
//

If you have problems or comments...

PBIL Back to PBIL home page