(data stored in SCRATCH zone)

EMBL: CP001778.PE589

CP001778.PE589       Location/Qualifiers
FT   CDS             628821..631415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0598"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Lanthionine synthetase C family protein;
FT                   SMART: serine/threonine protein kinase; KEGG: smt:Smal_2130
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40312"
FT                   /db_xref="GOA:D3Q613"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q613"
FT                   /inference="protein motif:PFAM:PF05147"
FT                   /protein_id="ADD40312.1"
FT                   /translation="MTARGAKASVPAIKATVSDLVLADGRYRIRRDANWLYADLVGHGL
FT                   ADHGWKFHVSSRPVDFRELMAVLVPFLLERGCVFKVARSLRVLGELNDGASAPASVGKA
FT                   VTIYPEQDRVARLGGELVELLRGWVGPRILSDRRVAVDAPVYYRYGPFRTTLVANRLGN
FT                   LTSVMAGPDGESFDGWATTAYQQPSWVVDPFRLGGEVGDVVGGRAVRLGTHYEPLAGLA
FT                   ESARGNVYTATDVRTGEVVVVKQARAYVAESLDGFDARTQLRNERFVLGALHDVAGVAR
FT                   FRDHFRHGEDEYLVTSFDGRFSLSEYVTRKGRYVPVERSEGGAGASELEESRSLDGLAH
FT                   RLAKTLRDIHARGFLLRDLSPKNLIVNATGDGVTFIDFGHCNHHDVVIRGGTKGYAPAR
FT                   QFDDEPAEPRDDLHALGMTLFAATIGAEPVVDEDDADASRVMALRVLGRMYGDRPPAVI
FT                   AAVADLLSADPETMTTAFTALVEGRLAGATRRPRFPAAVVHRRGPGTAALVERVLAQLV
FT                   SRANRIVDDGREPDPGVYRGAAGIGLCLLPHLERPGVADTVARLAKFSSLAADQVSLRP
FT                   GLYLGSTGVEVFLRRAIAAGVAATPLSPERLFGVADDGFEGVDVINGAAGIGLGHLLLN
FT                   EWDPRPEHEDVVRRCLEALGEPGAVFDPAEEAEVPGRDTTLGVSHGEGGVVEFLRHHHR
FT                   LAPSEESRRRLNTRVAVFAEQVRRFVEASAKPSAVPLCTSWCRGMAGMGRVVLAAGRQL
FT                   GDSSLVDLAVECADGCLRWLPQLATAGQCCGVAGIGELFCDLVSHDDRFLAAAESAATQ
FT                   LLILNADAPPAPPGRNQVQPGSTSWASGAAGVLDFLTRLRDLTPRGTAIAAF"
     MTARGAKASV PAIKATVSDL VLADGRYRIR RDANWLYADL VGHGLADHGW KFHVSSRPVD        60
     FRELMAVLVP FLLERGCVFK VARSLRVLGE LNDGASAPAS VGKAVTIYPE QDRVARLGGE       120
     LVELLRGWVG PRILSDRRVA VDAPVYYRYG PFRTTLVANR LGNLTSVMAG PDGESFDGWA       180
     TTAYQQPSWV VDPFRLGGEV GDVVGGRAVR LGTHYEPLAG LAESARGNVY TATDVRTGEV       240
     VVVKQARAYV AESLDGFDAR TQLRNERFVL GALHDVAGVA RFRDHFRHGE DEYLVTSFDG       300
     RFSLSEYVTR KGRYVPVERS EGGAGASELE ESRSLDGLAH RLAKTLRDIH ARGFLLRDLS       360
     PKNLIVNATG DGVTFIDFGH CNHHDVVIRG GTKGYAPARQ FDDEPAEPRD DLHALGMTLF       420
     AATIGAEPVV DEDDADASRV MALRVLGRMY GDRPPAVIAA VADLLSADPE TMTTAFTALV       480
     EGRLAGATRR PRFPAAVVHR RGPGTAALVE RVLAQLVSRA NRIVDDGREP DPGVYRGAAG       540
     IGLCLLPHLE RPGVADTVAR LAKFSSLAAD QVSLRPGLYL GSTGVEVFLR RAIAAGVAAT       600
     PLSPERLFGV ADDGFEGVDV INGAAGIGLG HLLLNEWDPR PEHEDVVRRC LEALGEPGAV       660
     FDPAEEAEVP GRDTTLGVSH GEGGVVEFLR HHHRLAPSEE SRRRLNTRVA VFAEQVRRFV       720
     EASAKPSAVP LCTSWCRGMA GMGRVVLAAG RQLGDSSLVD LAVECADGCL RWLPQLATAG       780
     QCCGVAGIGE LFCDLVSHDD RFLAAAESAA TQLLILNADA PPAPPGRNQV QPGSTSWASG       840
     AAGVLDFLTR LRDLTPRGTA IAAF                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page