(data stored in SCRATCH zone)

EMBL: CP001778.PE590

CP001778.PE590       Location/Qualifiers
FT   CDS             631438..632904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0599"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: scl:sce2246
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40313"
FT                   /db_xref="GOA:D3Q614"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q614"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADD40313.1"
FT                   /translation="MDAIEHDVVIAGGGPTGLMLAGELALAGVDVAVVERRVGQELPES
FT                   RAGGLHSRTIEVLDQRGIADRFLSRGKRSRAVGFATSQVDIGDLPTRHGYLLGLWQNHT
FT                   EHELAGWVGELDVPVYRGREVIGFAQDDSGVDIEVSDGGPMRARYLVGCDGGRSLVRKT
FT                   AGIDFPGWDPTFSCLVAEVEVERVPDWLSRQPVGPARRRAGSGKGTPVRIVVAESRVGR
FT                   TGEASLHDLSEALIAEYGTDYGVSNPSWISRFGDTSRQAASYRDRRVLLAGDAAHVHAP
FT                   VSGQGLNLGVQDAVNLGWKLAQVVAGASAESLLDTYHAERHPVAARVLRHTMAQHALLR
FT                   TDERTRSLRDIMSELLSLYEPRQRVAAMIAGLDIRYDCGEGHPLLGRRMPDLDLVTADG
FT                   PRRVFTLLHQARPVLLNLGEPNGFDVTPWAGRIRSVDAKAAATWELPLLGEVAAPAALV
FT                   IRPDGYVAWAGELTDASLPDALTSWFGEPE"
     MDAIEHDVVI AGGGPTGLML AGELALAGVD VAVVERRVGQ ELPESRAGGL HSRTIEVLDQ        60
     RGIADRFLSR GKRSRAVGFA TSQVDIGDLP TRHGYLLGLW QNHTEHELAG WVGELDVPVY       120
     RGREVIGFAQ DDSGVDIEVS DGGPMRARYL VGCDGGRSLV RKTAGIDFPG WDPTFSCLVA       180
     EVEVERVPDW LSRQPVGPAR RRAGSGKGTP VRIVVAESRV GRTGEASLHD LSEALIAEYG       240
     TDYGVSNPSW ISRFGDTSRQ AASYRDRRVL LAGDAAHVHA PVSGQGLNLG VQDAVNLGWK       300
     LAQVVAGASA ESLLDTYHAE RHPVAARVLR HTMAQHALLR TDERTRSLRD IMSELLSLYE       360
     PRQRVAAMIA GLDIRYDCGE GHPLLGRRMP DLDLVTADGP RRVFTLLHQA RPVLLNLGEP       420
     NGFDVTPWAG RIRSVDAKAA ATWELPLLGE VAAPAALVIR PDGYVAWAGE LTDASLPDAL       480
     TSWFGEPE                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page