(data stored in SCRATCH zone)

EMBL: CP001778.PE592

CP001778.PE592       Location/Qualifiers
FT   CDS             634081..636867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0601"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   Tetratricopeptide TPR_4; SMART: Tetratricopeptide domain
FT                   protein; KEGG: scl:sce5225 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40315"
FT                   /db_xref="GOA:D3Q6R6"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q6R6"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ADD40315.1"
FT                   /translation="MLVRLLGSVEIASATGWARAGPAKRSCVLAALAVTPRVPVTLATL
FT                   TERVWGTGAPSSAHSTLYGHIAHLRTLLRDCPGEVTLRRSGIDGYVLDVEPELIDVHAL
FT                   RSLVHAARDQLLVGDGERAVERWRRAGELVRGEALAGVKGDWAAEVRSGLRREHAALLA
FT                   ERFTVELELNRHNEIIDELADQVARHPLSESLVECLMTALYRSGRPAEALSCFAEARFR
FT                   LAERLGADPGTRLRELNRRILKQDPELARPTPASAPVARGGHPFAQLPAAPRLFTGRAA
FT                   ELSELDNALDAPDGARLWTVSGPGGIGKSWLALHWSHRRRDAFADGQLYVNLHGFDPGT
FT                   APTPPETALRGLLETLGVAPAAIPTSLDAMSGLYRSLLVGKRVLILVDDARDSRQVIPL
FT                   LPGDDAAFTVVTGRPGLATLATSHGAAGLRLDTLSHNESREAFSRHLGHDRIAAEPEAT
FT                   AELVGSCAGLPLALGILAARAAAHPGLPLAALAESVRDDSARLDALDTGELSASLRAVL
FT                   EGSLAAVRPEAARLFALLGLAPGIDAERHAVASLAAASLGHSDALLRELDSANLVEQRV
FT                   PGRYRMHDLTRLYAAERAEVDLDESDRDAALRRVVDHYLYTAAAGRELMQRGLIPRDLG
FT                   QPAPGCVTRPLTDLEAAKRWFAAEHVNIVAAQRKAAELGWDASVWRLAWALTTFQILRR
FT                   RSDEGVPVWRRAVAAAENLDDLFGQVVAHHTLSQMLIYAGDYDDAATHAARALDRAEAS
FT                   GDVHQLVGAHDAMSKAYVRQGDYRLALRHSTRSLDLARRTGNQILEAQAHNSVGWHLAH
FT                   LGEYAAARGHCEQALDKARAIPDDYLAALILDSLGFVASRDDRPADASVHYRQALELVR
FT                   RFGATEQEPTTMVALAEAEEALGRRDEAERLRREAADLYEAQGYAEEAALLRKPASG"
     MLVRLLGSVE IASATGWARA GPAKRSCVLA ALAVTPRVPV TLATLTERVW GTGAPSSAHS        60
     TLYGHIAHLR TLLRDCPGEV TLRRSGIDGY VLDVEPELID VHALRSLVHA ARDQLLVGDG       120
     ERAVERWRRA GELVRGEALA GVKGDWAAEV RSGLRREHAA LLAERFTVEL ELNRHNEIID       180
     ELADQVARHP LSESLVECLM TALYRSGRPA EALSCFAEAR FRLAERLGAD PGTRLRELNR       240
     RILKQDPELA RPTPASAPVA RGGHPFAQLP AAPRLFTGRA AELSELDNAL DAPDGARLWT       300
     VSGPGGIGKS WLALHWSHRR RDAFADGQLY VNLHGFDPGT APTPPETALR GLLETLGVAP       360
     AAIPTSLDAM SGLYRSLLVG KRVLILVDDA RDSRQVIPLL PGDDAAFTVV TGRPGLATLA       420
     TSHGAAGLRL DTLSHNESRE AFSRHLGHDR IAAEPEATAE LVGSCAGLPL ALGILAARAA       480
     AHPGLPLAAL AESVRDDSAR LDALDTGELS ASLRAVLEGS LAAVRPEAAR LFALLGLAPG       540
     IDAERHAVAS LAAASLGHSD ALLRELDSAN LVEQRVPGRY RMHDLTRLYA AERAEVDLDE       600
     SDRDAALRRV VDHYLYTAAA GRELMQRGLI PRDLGQPAPG CVTRPLTDLE AAKRWFAAEH       660
     VNIVAAQRKA AELGWDASVW RLAWALTTFQ ILRRRSDEGV PVWRRAVAAA ENLDDLFGQV       720
     VAHHTLSQML IYAGDYDDAA THAARALDRA EASGDVHQLV GAHDAMSKAY VRQGDYRLAL       780
     RHSTRSLDLA RRTGNQILEA QAHNSVGWHL AHLGEYAAAR GHCEQALDKA RAIPDDYLAA       840
     LILDSLGFVA SRDDRPADAS VHYRQALELV RRFGATEQEP TTMVALAEAE EALGRRDEAE       900
     RLRREAADLY EAQGYAEEAA LLRKPASG                                          928
//

If you have problems or comments...

PBIL Back to PBIL home page