(data stored in SCRATCH zone)

EMBL: CP001778.PE595

CP001778.PE595       Location/Qualifiers
FT   CDS             638803..639981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0604"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: cja:CJA_1508 succinyl-CoA synthetase beta
FT                   chain; TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   PFAM: ATP-grasp domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40318"
FT                   /db_xref="GOA:D3Q6R9"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q6R9"
FT                   /inference="protein motif:TFAM:TIGR01016"
FT                   /protein_id="ADD40318.1"
FT                   /translation="MDLYEYQGRALFARHGVPVLDGGVAETVEEAVELAGKLDGRVVVK
FT                   AQVKVGGRGKAGGVKLADNVDEAREHATNILGMDIKGHTVHKVMLTVTADIDTEFYFSF
FT                   LLDRANRTFLCIASTEGGVEIEQVAAETPDKVLKLPINALTGVDATVAGEIADKAGFPA
FT                   DLRPQLVDMFVKLWETFVSEDATLVEVNPLVRTPEGRALALDAKVTLDENAAFRHLDHA
FT                   ELEDKAAVDPLEQRAKEADLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHDNVKPA
FT                   NFLDIGGGASAAVMASGLEVVLSDPAVKSVFVNVFGGITACDEVANGIVGALTMLAERG
FT                   ETVDKPLVVRLDGNNAELGRSILDGANHPLVTRVDTMDGAADKAAELAAQGA"
     MDLYEYQGRA LFARHGVPVL DGGVAETVEE AVELAGKLDG RVVVKAQVKV GGRGKAGGVK        60
     LADNVDEARE HATNILGMDI KGHTVHKVML TVTADIDTEF YFSFLLDRAN RTFLCIASTE       120
     GGVEIEQVAA ETPDKVLKLP INALTGVDAT VAGEIADKAG FPADLRPQLV DMFVKLWETF       180
     VSEDATLVEV NPLVRTPEGR ALALDAKVTL DENAAFRHLD HAELEDKAAV DPLEQRAKEA       240
     DLNYVKLDGE VGIIGNGAGL VMSTLDVVAY AGEKHDNVKP ANFLDIGGGA SAAVMASGLE       300
     VVLSDPAVKS VFVNVFGGIT ACDEVANGIV GALTMLAERG ETVDKPLVVR LDGNNAELGR       360
     SILDGANHPL VTRVDTMDGA ADKAAELAAQ GA                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page