(data stored in SCRATCH zone)

EMBL: CP001778.PE62

CP001778.PE62        Location/Qualifiers
FT   CDS             complement(67067..67744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppw:PputW619_2819 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39785"
FT                   /db_xref="GOA:D3Q0C1"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0C1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39785.1"
FT                   /translation="MAIALLASGVVYASWLLGGWVNPGLGPVVSYASELAASDQPGSLA
FT                   FRIGDLVAGAAACVAGLWALRRRPWLGWACVVAFGVFTMLDAGLFNMSCAPSLDPTCAT
FT                   AEVAGKVPLRHQIHTLSSSLAAAAPFVGLIAFAWAWRTVTAWVLSGLMVAATAATMLAV
FT                   ATDHLVGVAQRLQLLIVSAWLVWLALRTWRATSSDPTAARTATANLAPSEQPTAVDTNG
FT                   ARP"
     MAIALLASGV VYASWLLGGW VNPGLGPVVS YASELAASDQ PGSLAFRIGD LVAGAAACVA        60
     GLWALRRRPW LGWACVVAFG VFTMLDAGLF NMSCAPSLDP TCATAEVAGK VPLRHQIHTL       120
     SSSLAAAAPF VGLIAFAWAW RTVTAWVLSG LMVAATAATM LAVATDHLVG VAQRLQLLIV       180
     SAWLVWLALR TWRATSSDPT AARTATANLA PSEQPTAVDT NGARP                       225
//

If you have problems or comments...

PBIL Back to PBIL home page