(data stored in SCRATCH zone)

EMBL: CP001778.PE64

CP001778.PE64        Location/Qualifiers
FT   CDS             complement(71640..74444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0065"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   Tetratricopeptide TPR_4; NB-ARC domain protein;
FT                   transcriptional regulator domain protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: scl:sce6858
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39787"
FT                   /db_xref="GOA:D3Q0C3"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0C3"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ADD39787.1"
FT                   /translation="MRFETLGPLRVSDESGVLPLRGRKARVLLAVLVSRAGDAVPIDVL
FT                   ARAIWDDKVPDTAIKTLRWHIHQLRRLLGDANRITYDDGGYRLRADPSEVDSFGFERLC
FT                   ADGFAAQRSRDPVIAARCFTEALKLWRGPAFGDLVDCGILRDEAARLDQLYLDATEQRH
FT                   GVELDLGNHEEVLAELTELVERYPLRENLRAHLMVALYRCGRRSEALEMFRAGRELFAE
FT                   QLGLDPAPRLRELEKAILNSDPALDPPSATRSGPAELPRDIATFTGREAEVSELTELLV
FT                   TDSMTPLVISSINGGGGVGKSALAIHLGHLVRERFPDGQLYVNLQGATPNAEPLEPAEV
FT                   LRRFLRSLGVGGDDGISEVAELANRLRTATNGKRMLFLLDDARDSGQVRPLLPSEPRCA
FT                   VLITSRRTLSTLDGSVNRALDGLSDADAVTLLERLVGTDRVAAEPEAVRRLLGWCGGMP
FT                   LALRICAARLVARPRWSVASLADELADETRRLSELEVDDLAIRSSFAVGYRQLCEDSAS
FT                   AARVFRLLGLHDGPDFTTRHVAALAELDEPDAERSLAELTATHLVEPAGPGRYRTHDLM
FT                   RLFARERVTAEESAAERRASVERERRFYLGTVRNMLGVCEPGMRNRLGLVPEEFVRHGV
FT                   RFEDAKSAYAWAMADTANLLAICRAAIGGGATDDPDFTATTVTVLGPVLVIRGSAGPMA
FT                   DLHELGIKARKWVTKPDLRFFISTGAAELMRVAGKHDEALRHLEVAMSISREQGWRVRE
FT                   GWILVGVGTMYWWMGELDQATDHLDRAVAIAAETGDRALEGSATSHLGHVHAESGRHDA
FT                   AIEAMRKVLAFAQDSGRPRGRVEGMISLGRVYQLADRPTEARDCYERATAMLDETGLAG
FT                   TRYEAEALWGLADAGHALGETELTRERWDRAAKLLFDLKLIDAGERDHIISVPEPDRPK
FT                   AIRY"
     MRFETLGPLR VSDESGVLPL RGRKARVLLA VLVSRAGDAV PIDVLARAIW DDKVPDTAIK        60
     TLRWHIHQLR RLLGDANRIT YDDGGYRLRA DPSEVDSFGF ERLCADGFAA QRSRDPVIAA       120
     RCFTEALKLW RGPAFGDLVD CGILRDEAAR LDQLYLDATE QRHGVELDLG NHEEVLAELT       180
     ELVERYPLRE NLRAHLMVAL YRCGRRSEAL EMFRAGRELF AEQLGLDPAP RLRELEKAIL       240
     NSDPALDPPS ATRSGPAELP RDIATFTGRE AEVSELTELL VTDSMTPLVI SSINGGGGVG       300
     KSALAIHLGH LVRERFPDGQ LYVNLQGATP NAEPLEPAEV LRRFLRSLGV GGDDGISEVA       360
     ELANRLRTAT NGKRMLFLLD DARDSGQVRP LLPSEPRCAV LITSRRTLST LDGSVNRALD       420
     GLSDADAVTL LERLVGTDRV AAEPEAVRRL LGWCGGMPLA LRICAARLVA RPRWSVASLA       480
     DELADETRRL SELEVDDLAI RSSFAVGYRQ LCEDSASAAR VFRLLGLHDG PDFTTRHVAA       540
     LAELDEPDAE RSLAELTATH LVEPAGPGRY RTHDLMRLFA RERVTAEESA AERRASVERE       600
     RRFYLGTVRN MLGVCEPGMR NRLGLVPEEF VRHGVRFEDA KSAYAWAMAD TANLLAICRA       660
     AIGGGATDDP DFTATTVTVL GPVLVIRGSA GPMADLHELG IKARKWVTKP DLRFFISTGA       720
     AELMRVAGKH DEALRHLEVA MSISREQGWR VREGWILVGV GTMYWWMGEL DQATDHLDRA       780
     VAIAAETGDR ALEGSATSHL GHVHAESGRH DAAIEAMRKV LAFAQDSGRP RGRVEGMISL       840
     GRVYQLADRP TEARDCYERA TAMLDETGLA GTRYEAEALW GLADAGHALG ETELTRERWD       900
     RAAKLLFDLK LIDAGERDHI ISVPEPDRPK AIRY                                   934
//

If you have problems or comments...

PBIL Back to PBIL home page