(data stored in SCRATCH zone)

EMBL: CP001778.PE69

CP001778.PE69        Location/Qualifiers
FT   CDS             77299..78162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39792"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0C8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39792.1"
FT                   /translation="MTNMTGAIHEAVDAIGTAIIYAESRKGSWVFEQQEWLDFVRELSP
FT                   LMHHQYGRLANCDPSPAKAASKRIESGKTSLAKNANPNGSLESQTKRIKKLCETWRSDG
FT                   GYAFHSHIGKMEFALLHQQEMAAVLSSLMELHSSHVLATQEDLLNIANLTIDSLERHGY
FT                   DIQQKERQKLGAILDTLVSVASGGIVGSLGSGAAKAVGEAVSGIKGSSAVSAAMQLPTD
FT                   DTMLIIKTMKRKVDQLIEQTTAQQSQIRVALTSVFEAYVDKPIMLPPEVATGTLSDQDW
FT                   RYATRR"
     MTNMTGAIHE AVDAIGTAII YAESRKGSWV FEQQEWLDFV RELSPLMHHQ YGRLANCDPS        60
     PAKAASKRIE SGKTSLAKNA NPNGSLESQT KRIKKLCETW RSDGGYAFHS HIGKMEFALL       120
     HQQEMAAVLS SLMELHSSHV LATQEDLLNI ANLTIDSLER HGYDIQQKER QKLGAILDTL       180
     VSVASGGIVG SLGSGAAKAV GEAVSGIKGS SAVSAAMQLP TDDTMLIIKT MKRKVDQLIE       240
     QTTAQQSQIR VALTSVFEAY VDKPIMLPPE VATGTLSDQD WRYATRR                     287
//

If you have problems or comments...

PBIL Back to PBIL home page