(data stored in SCRATCH zone)

EMBL: CP001778.PE70

CP001778.PE70        Location/Qualifiers
FT   CDS             78289..80472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0071"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; KEGG: scl:sce0368 putative
FT                   iron-sulfur protein, transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39793"
FT                   /db_xref="GOA:D3Q0C9"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0C9"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADD39793.1"
FT                   /translation="MGVVQIVATLIAAVVTIVAITVFARTGMSMVRIIKLGAPDPTRRN
FT                   KGAVRLKTMLRETVGHTRMLKWTLVGAAHWFVFVAFITLFPVLVEAYLKVINPTWTLPF
FT                   VGHWSLWLLYTETIGALGIAGIVALFVVRMLNQPRNNPAPERPEGTELSEAHTRTSTSR
FT                   FERSRQWQGFYIEATIFGIIASHFITRSLKVAAGELDVPAWAAPISNAIGGAMSGLGEA
FT                   ALTPITIVALVEIIISWLFFYILGRNITMGLGWHRITAFFNIYFKRNADGPVSLGAAKP
FT                   LMVRGEPIDFENADPETDPFGVGQVEQFTWKGLLDFTTCTECGRCQSQCPAWNTDKPLS
FT                   PKLLITDLREHLYAKAPYLLAGGGKDALGEETGTAEQLKDVPADALAEAEKSLVGDVID
FT                   PDVLWSCTTCGACVEQCPVDIEHVDHIVDMRRHQVMIESAFPSEAQTLMRNLENKGNPW
FT                   GAAPNTREDWTKGLDFEVPRVDSASPDFEYLFWVGCAGAFDDKAVKTTQAVATLLYEAE
FT                   VKYAILGNGETCTGDPARRSGNEFLFSMLAEQNVETLNEAKVTKIVATCPHCLNTLGNE
FT                   YGQLGGNYEVIHHTELLSNLIAERRLKPVTKLENGVTYHDPCYLGRHNRVFSPPRELLG
FT                   EVSATGLTEMPRNSEKSFCCGAGGARMWMEEKIGTRININRSTEAVETGAKTVAVACPF
FT                   CSTMINDGVNAVGAGDDVEVVDVAQILLRNTRE"
     MGVVQIVATL IAAVVTIVAI TVFARTGMSM VRIIKLGAPD PTRRNKGAVR LKTMLRETVG        60
     HTRMLKWTLV GAAHWFVFVA FITLFPVLVE AYLKVINPTW TLPFVGHWSL WLLYTETIGA       120
     LGIAGIVALF VVRMLNQPRN NPAPERPEGT ELSEAHTRTS TSRFERSRQW QGFYIEATIF       180
     GIIASHFITR SLKVAAGELD VPAWAAPISN AIGGAMSGLG EAALTPITIV ALVEIIISWL       240
     FFYILGRNIT MGLGWHRITA FFNIYFKRNA DGPVSLGAAK PLMVRGEPID FENADPETDP       300
     FGVGQVEQFT WKGLLDFTTC TECGRCQSQC PAWNTDKPLS PKLLITDLRE HLYAKAPYLL       360
     AGGGKDALGE ETGTAEQLKD VPADALAEAE KSLVGDVIDP DVLWSCTTCG ACVEQCPVDI       420
     EHVDHIVDMR RHQVMIESAF PSEAQTLMRN LENKGNPWGA APNTREDWTK GLDFEVPRVD       480
     SASPDFEYLF WVGCAGAFDD KAVKTTQAVA TLLYEAEVKY AILGNGETCT GDPARRSGNE       540
     FLFSMLAEQN VETLNEAKVT KIVATCPHCL NTLGNEYGQL GGNYEVIHHT ELLSNLIAER       600
     RLKPVTKLEN GVTYHDPCYL GRHNRVFSPP RELLGEVSAT GLTEMPRNSE KSFCCGAGGA       660
     RMWMEEKIGT RININRSTEA VETGAKTVAV ACPFCSTMIN DGVNAVGAGD DVEVVDVAQI       720
     LLRNTRE                                                                 727
//

If you have problems or comments...

PBIL Back to PBIL home page