(data stored in SCRATCH zone)

EMBL: CP001778.PE77

CP001778.PE77        Location/Qualifiers
FT   CDS             87756..88367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0078"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein; KEGG:
FT                   dia:Dtpsy_1254 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39800"
FT                   /db_xref="GOA:D3Q0D6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0D6"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADD39800.1"
FT                   /translation="MTSSVTGQLTTPWTVRERAPDTPRRAVHADLEREYVEYVTVHLPA
FT                   LHRVARLLCRDRHRADDIVQTTITKLYIHWKRAKAASNLDAYVRTMLVRAFLSEQRLSW
FT                   AKVRLFGSAQEIPGTPSVHSPDVETRDLVHTALSRVAPKQRAVLVLRFLCDLPVTEVAQ
FT                   ILGCSPGNVTSLTTHGLKRLRALLGDRAVAALEGGGRDER"
     MTSSVTGQLT TPWTVRERAP DTPRRAVHAD LEREYVEYVT VHLPALHRVA RLLCRDRHRA        60
     DDIVQTTITK LYIHWKRAKA ASNLDAYVRT MLVRAFLSEQ RLSWAKVRLF GSAQEIPGTP       120
     SVHSPDVETR DLVHTALSRV APKQRAVLVL RFLCDLPVTE VAQILGCSPG NVTSLTTHGL       180
     KRLRALLGDR AVAALEGGGR DER                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page