(data stored in SCRATCH zone)

EMBL: CP001778.PE90

CP001778.PE90        Location/Qualifiers
FT   CDS             99782..100633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0092"
FT                   /product="N-acetyltransferase"
FT                   /note="PFAM: N-acetyltransferase; KEGG: bra:BRADO6242
FT                   putative arylamine N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39813"
FT                   /db_xref="GOA:D3Q0E9"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0E9"
FT                   /inference="protein motif:PFAM:PF00797"
FT                   /protein_id="ADD39813.1"
FT                   /translation="MWNSEQLDLDAYLTRVGHDGDRTPTLATLRALQRAHVLNLRWDTI
FT                   DSFLYREVRLDLAAIQDKLLRRGRGGYCYEHTVLFAAVLEKLGFRFTAVSARVQLGADS
FT                   TTPRPATHAMLIVDLDGKRWLSDVGFGSSPLEPIELVDGGRGDSGPWPYLLRWQDITHG
FT                   SPGWAVHQRGDGPEGPEGWTVRQVFTETPQYPIDYVLGNHFVASNDRSPFVTRPYIQRL
FT                   RTDRYDTLDALTWTTERPGQDAVSETVRPHEVPKLLDDVFDIRVDAAEARLLVDRLTER
FT                   EA"
     MWNSEQLDLD AYLTRVGHDG DRTPTLATLR ALQRAHVLNL RWDTIDSFLY REVRLDLAAI        60
     QDKLLRRGRG GYCYEHTVLF AAVLEKLGFR FTAVSARVQL GADSTTPRPA THAMLIVDLD       120
     GKRWLSDVGF GSSPLEPIEL VDGGRGDSGP WPYLLRWQDI THGSPGWAVH QRGDGPEGPE       180
     GWTVRQVFTE TPQYPIDYVL GNHFVASNDR SPFVTRPYIQ RLRTDRYDTL DALTWTTERP       240
     GQDAVSETVR PHEVPKLLDD VFDIRVDAAE ARLLVDRLTE REA                         283
//

If you have problems or comments...

PBIL Back to PBIL home page