(data stored in SCRATCH zone)

EMBL: CP001778.PE92

CP001778.PE92        Location/Qualifiers
FT   CDS             101455..102390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0094"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   eba:ebA3370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39815"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0F1"
FT                   /inference="protein motif:PFAM:PF02636"
FT                   /protein_id="ADD39815.1"
FT                   /translation="MLPWSQAMRRALYGPGGFYTLNSPNRHFRTSAQFPLFATAIAELV
FT                   RRTDSRLDHPEVFNLVDVGAGSGELLRRVLDEEDLNGRLRPVAVELRPAPPGLDERIEW
FT                   RTSLPGGIIGLLMACEYLDNMPLDIAVADAAGAVRYELVDPGSGETRPGQPVSSVDADW
FT                   LRAWWPLGQAGQRAEIGRSRDQEWARLCGNVSRGTVVAVDYGHTKDCRPPLGTVTGFLD
FT                   GHQVAPVPDGTRDITAHVAMDSLGDGGLWTQRDALRELGISGSRPPLELSRTNPAEYIR
FT                   ALSRAGDAAELTDPAGLGAHHWLVLNLTQR"
     MLPWSQAMRR ALYGPGGFYT LNSPNRHFRT SAQFPLFATA IAELVRRTDS RLDHPEVFNL        60
     VDVGAGSGEL LRRVLDEEDL NGRLRPVAVE LRPAPPGLDE RIEWRTSLPG GIIGLLMACE       120
     YLDNMPLDIA VADAAGAVRY ELVDPGSGET RPGQPVSSVD ADWLRAWWPL GQAGQRAEIG       180
     RSRDQEWARL CGNVSRGTVV AVDYGHTKDC RPPLGTVTGF LDGHQVAPVP DGTRDITAHV       240
     AMDSLGDGGL WTQRDALREL GISGSRPPLE LSRTNPAEYI RALSRAGDAA ELTDPAGLGA       300
     HHWLVLNLTQ R                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page