(data stored in ACNUC7421 zone)

EMBL: CP001791.PE10

CP001791.PE10        Location/Qualifiers
FT   CDS             complement(17324..17674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0010"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: cvi:CV_3776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97562"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV04"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADH97562.1"
FT                   /translation="MNESKWHMQISKGILEVAIMKLVEHEERYGYEITGMIQKGGTLSI
FT                   ANGSIYPILKRLEEQEWIVSRQIEHNGRLRKYYRLTKAGHTQLKVRERYLQELNQLLVT
FT                   LDQREAGNRDHR"
     MNESKWHMQI SKGILEVAIM KLVEHEERYG YEITGMIQKG GTLSIANGSI YPILKRLEEQ        60
     EWIVSRQIEH NGRLRKYYRL TKAGHTQLKV RERYLQELNQ LLVTLDQREA GNRDHR           116
//

If you have problems or comments...

PBIL Back to PBIL home page