(data stored in ACNUC7421 zone)

EMBL: CP001791.PE100

CP001791.PE100       Location/Qualifiers
FT   CDS             123633..124133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0103"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: rpf:Rpic12D_2969
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97652"
FT                   /db_xref="GOA:D6XVM9"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVM9"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ADH97652.1"
FT                   /translation="MSAVIEQKKQVVDEIKTKLEESQSTIVVDYRGLDVSEITELRKQL
FT                   REAGVDFKVYKNSMVRRATEAAGLTDLDEHLTGPTAIAFSNEDVVAPAKILNGFAKDHE
FT                   ALELKAGVIEGKVTGLEEIKALATLPSRDGLVSMLLSVLQAPIRNFALATKAVADQKEE
FT                   QEA"
     MSAVIEQKKQ VVDEIKTKLE ESQSTIVVDY RGLDVSEITE LRKQLREAGV DFKVYKNSMV        60
     RRATEAAGLT DLDEHLTGPT AIAFSNEDVV APAKILNGFA KDHEALELKA GVIEGKVTGL       120
     EEIKALATLP SRDGLVSMLL SVLQAPIRNF ALATKAVADQ KEEQEA                      166
//

If you have problems or comments...

PBIL Back to PBIL home page