(data stored in ACNUC7421 zone)

EMBL: CP001791.PE101

CP001791.PE101       Location/Qualifiers
FT   CDS             124204..124569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0104"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="KEGG: vha:VIBHAR_00226 50S ribosomal protein L7/L12;
FT                   TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97653"
FT                   /db_xref="GOA:D6XVN0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN0"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ADH97653.1"
FT                   /translation="MTHQDMIAAIKEMSVLELNDLVKAIEEEFGVTAAAPVAAAGAGAG
FT                   EEAAAEQTEFDVVLESAGSSKIGVIKIVREITGLGLKDAKALVDGVPAPVKEGVEKAEA
FT                   EEIKGKLEEAGASVELK"
     MTHQDMIAAI KEMSVLELND LVKAIEEEFG VTAAAPVAAA GAGAGEEAAA EQTEFDVVLE        60
     SAGSSKIGVI KIVREITGLG LKDAKALVDG VPAPVKEGVE KAEAEEIKGK LEEAGASVEL       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page