(data stored in ACNUC7421 zone)

EMBL: CP001791.PE102

CP001791.PE102       Location/Qualifiers
FT   CDS             124700..125305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0105"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; putative RNA
FT                   methylase; KEGG: tgr:Tgr7_2883 methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97654"
FT                   /db_xref="GOA:D6XVN1"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN1"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADH97654.1"
FT                   /translation="MSDHYYTNKPGVKSSRRSFTDELRGQRLTFTVDKGVFSGGGVDFG
FT                   SRLLIESFTEPETEGDLLDIGCGWGPIGIALAMSTDQRRINMIDVNERSVELARLNAEA
FT                   NGVADNVHIEQRDATEGLPGDGCAAILTNPPIRAGKDVVFAIYEEASRQLKHGGELWVV
FT                   IQKKQGAPSTEEKLKALGLDVRTVTKKKGYVIFAGKKD"
     MSDHYYTNKP GVKSSRRSFT DELRGQRLTF TVDKGVFSGG GVDFGSRLLI ESFTEPETEG        60
     DLLDIGCGWG PIGIALAMST DQRRINMIDV NERSVELARL NAEANGVADN VHIEQRDATE       120
     GLPGDGCAAI LTNPPIRAGK DVVFAIYEEA SRQLKHGGEL WVVIQKKQGA PSTEEKLKAL       180
     GLDVRTVTKK KGYVIFAGKK D                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page