(data stored in ACNUC7421 zone)

EMBL: CP001791.PE103

CP001791.PE103       Location/Qualifiers
FT   CDS             125727..129272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0106"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   KEGG: similar to DNA-directed RNA polymerase beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 7; RNA polymerase Rpb2
FT                   domain 3; RNA polymerase Rpb2 domain 2; DNA-directed RNA
FT                   polymerase, beta subunit, external 1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97655"
FT                   /db_xref="GOA:D6XVN2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN2"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ADH97655.1"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLDLPNLIEIQTASYQWFLDEGI
FT                   REMFQDISPISDFTGNLVLEFIDYSLGDPKYPVDESKERDVTYSAPLRVKVRLINQETG
FT                   EVKEQEVFMGDFPLMTDTGTFIINGAERVIVSQLVRSPSVYFNNKVDKNGKKGYTATVI
FT                   PNRGAWLELETDAKDVVYVRIDRTRKIPATVLLRALGFGSDQEIIDLLGEDAYLRNTLD
FT                   KDNTDSSEKALLEIYERLRPGEPPTVESAKSLLDSRFFDPKRYDLASVGRYKMNKKLHI
FT                   KNRLFNQKLAETLVDPDTGEILAEEGTVIDRRVLDKLMPYLENNLGFRRINLNGGVVDD
FT                   EETEIQSVMIYSQEPTAEEGEKIKVIANGTVGEKVKNITPADIIASVSYFFNLLHGVGN
FT                   TDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNVITPQALINIRPVIA
FT                   SIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMC
FT                   PIETPEGPNIGLINSLSSYAKVNPFGFIESPYRKVDHDTGIVSEQVDYLTADEEDNYIV
FT                   AQANAKLNEDGTFTDENIICRFRGENIIVSRDRVDYMDVSPKQVVSAATACIPFLENDD
FT                   SNRALMGANMQRQAVPLLEPHSPLVGTGMEYVSAKDSGAAIVARARGRVEKVTAKFVDV
FT                   RELADVDGKETEGDLKRYNFMKFERSNQGTCYNQRPIVSEGMIVEKGEILADGSSMEKG
FT                   EMALGQNVLVGFMTWDGYNYEDAIILSERLVKDDVYTSIHIEEYESEARDTKLGPEEIT
FT                   RDIPNVGEDALRNLDERGIIRTGAEVKDGDILVGKVTPKGVTELTAEERLLHAIFGEKA
FT                   REVRDTSLRAPHGGDGIVLDVKVFNREDGDELPPGVNQLVRVYIVQKRKINEGDKMAGR
FT                   HGNKGVISRILPEEDMPFLPDGTPIDIMLNPLGVPSRMNIGQVLELHMGMAARQLGIHI
FT                   ATPVFDGAREEDVWETIEEAGMARDGKTVLYDGRTGEPFDSRVSVGVMYMIKLAHMVDD
FT                   KLHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDTIG
FT                   RVKTYEAIVKGENVPEPGVPESFKVLIKELQSLGMDVKMLSSNDEEIDMLEHEDDDEQT
FT                   GDKLNLNMESGESNA"
     MTGQLVQYGR HRQRRSYARI SEVLDLPNLI EIQTASYQWF LDEGIREMFQ DISPISDFTG        60
     NLVLEFIDYS LGDPKYPVDE SKERDVTYSA PLRVKVRLIN QETGEVKEQE VFMGDFPLMT       120
     DTGTFIINGA ERVIVSQLVR SPSVYFNNKV DKNGKKGYTA TVIPNRGAWL ELETDAKDVV       180
     YVRIDRTRKI PATVLLRALG FGSDQEIIDL LGEDAYLRNT LDKDNTDSSE KALLEIYERL       240
     RPGEPPTVES AKSLLDSRFF DPKRYDLASV GRYKMNKKLH IKNRLFNQKL AETLVDPDTG       300
     EILAEEGTVI DRRVLDKLMP YLENNLGFRR INLNGGVVDD EETEIQSVMI YSQEPTAEEG       360
     EKIKVIANGT VGEKVKNITP ADIIASVSYF FNLLHGVGNT DDIDHLGNRR LRSVGELLQN       420
     QFRIGLSRME RVVRERMSIQ DTNVITPQAL INIRPVIASI KEFFGSSQLS QFMDQTNPLA       480
     ELTHKRRLSA LGPGGLTRER AGFEVRDVHY SHYGRMCPIE TPEGPNIGLI NSLSSYAKVN       540
     PFGFIESPYR KVDHDTGIVS EQVDYLTADE EDNYIVAQAN AKLNEDGTFT DENIICRFRG       600
     ENIIVSRDRV DYMDVSPKQV VSAATACIPF LENDDSNRAL MGANMQRQAV PLLEPHSPLV       660
     GTGMEYVSAK DSGAAIVARA RGRVEKVTAK FVDVRELADV DGKETEGDLK RYNFMKFERS       720
     NQGTCYNQRP IVSEGMIVEK GEILADGSSM EKGEMALGQN VLVGFMTWDG YNYEDAIILS       780
     ERLVKDDVYT SIHIEEYESE ARDTKLGPEE ITRDIPNVGE DALRNLDERG IIRTGAEVKD       840
     GDILVGKVTP KGVTELTAEE RLLHAIFGEK AREVRDTSLR APHGGDGIVL DVKVFNREDG       900
     DELPPGVNQL VRVYIVQKRK INEGDKMAGR HGNKGVISRI LPEEDMPFLP DGTPIDIMLN       960
     PLGVPSRMNI GQVLELHMGM AARQLGIHIA TPVFDGAREE DVWETIEEAG MARDGKTVLY      1020
     DGRTGEPFDS RVSVGVMYMI KLAHMVDDKL HARSTGPYSL VTQQPLGGKA QFGGQRFGEM      1080
     EVWALEAYGA AYTLQEILTV KSDDTIGRVK TYEAIVKGEN VPEPGVPESF KVLIKELQSL      1140
     GMDVKMLSSN DEEIDMLEHE DDDEQTGDKL NLNMESGESN A                          1181
//

If you have problems or comments...

PBIL Back to PBIL home page