(data stored in ACNUC7421 zone)

EMBL: CP001791.PE106

CP001791.PE106       Location/Qualifiers
FT   CDS             133451..133864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0109"
FT                   /product="ribosomal protein S12"
FT                   /note="KEGG: gem:GM21_3333 ribosomal protein S12; TIGRFAM:
FT                   ribosomal protein S12; PFAM: ribosomal protein S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97658"
FT                   /db_xref="GOA:D6XVN5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN5"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADH97658.1"
FT                   /translation="MPTINQLVRKGRKSKVKSPDSPALNKGYNSFKKHQTDEDSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNQIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGSLDTAGVEGRMQSRSKYGTKRPKK"
     MPTINQLVRK GRKSKVKSPD SPALNKGYNS FKKHQTDEDS PQKRGVCTRV GTMTPKKPNS        60
     ALRKYARVRL TNQIEVTAYI PGIGHNLQEH SVVLIRGGRV KDLPGVRYHI VRGSLDTAGV       120
     EGRMQSRSKY GTKRPKK                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page