(data stored in ACNUC7421 zone)

EMBL: CP001791.PE108

CP001791.PE108       Location/Qualifiers
FT   CDS             134494..136572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0111"
FT                   /product="translation elongation factor G"
FT                   /note="KEGG: gsu:GSU2860 elongation factor G; TIGRFAM:
FT                   translation elongation factor G; small GTP-binding protein;
FT                   PFAM: protein synthesis factor GTP-binding; elongation
FT                   factor G domain protein; elongation factor Tu domain 2
FT                   protein; elongation factor G domain IV"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97660"
FT                   /db_xref="GOA:D6XVN7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN7"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADH97660.1"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTATERILFYSGRIHKIGETHD
FT                   GGSQMDWMEQEQERGITITSAATTAQWNEHRINIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKLGADFIYSLGTLEDRLGANAAAVQ
FT                   LPIGAEDDFEGIIDLINMQAYFYLDDLGTRSEAREIPDEYKDQAEEYRDKLMEKVSEFD
FT                   EDFMMKYLEGEEITTDELKRAIRAATVSVEFYPVFCGSAFKNKGVQLLLDGVIDYLPAP
FT                   TDVAAITGIDLDTEEEVVRKPGDNEPFSALAFKVATDPFVGKLTFFRVYSGMVNAGSYV
FT                   KNSTKGKRERMGRILQMHANHREEIPTCFSGDIAAGVGLKDTGTGDTLCGEKENIILES
FT                   MEFPDPVISLSVEPKSKADQDKMGMALAKLAEEDPTFKTHTDDETGQTIIAGMGELHLD
FT                   IIVDRMRREFKVDANVGAPQVSYRETLRQAANCEGKFVRQSGGRGQYGHVWIEFMPNDE
FT                   GAGFEFVDNIVGGVVPREYIGSVEAGVKDALDNGLLAGYPLVDVKARLYDGSYHDVDSN
FT                   EMAFKVAASMALKEAKKKCNPVLLEPIMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEAR
FT                   GNAQIVKAMVPLSEMFGYATSLRSNTQGRGNYSMHFDHYEEVPKSISEEIIKKQGGE"
     MAREFSLEKT RNIGIMAHID AGKTTATERI LFYSGRIHKI GETHDGGSQM DWMEQEQERG        60
     ITITSAATTA QWNEHRINII DTPGHVDFTV EVERSLRVLD GAVAVLDAQS GVEPQTETVW       120
     RQATTYGVPR IVFVNKMDKL GADFIYSLGT LEDRLGANAA AVQLPIGAED DFEGIIDLIN       180
     MQAYFYLDDL GTRSEAREIP DEYKDQAEEY RDKLMEKVSE FDEDFMMKYL EGEEITTDEL       240
     KRAIRAATVS VEFYPVFCGS AFKNKGVQLL LDGVIDYLPA PTDVAAITGI DLDTEEEVVR       300
     KPGDNEPFSA LAFKVATDPF VGKLTFFRVY SGMVNAGSYV KNSTKGKRER MGRILQMHAN       360
     HREEIPTCFS GDIAAGVGLK DTGTGDTLCG EKENIILESM EFPDPVISLS VEPKSKADQD       420
     KMGMALAKLA EEDPTFKTHT DDETGQTIIA GMGELHLDII VDRMRREFKV DANVGAPQVS       480
     YRETLRQAAN CEGKFVRQSG GRGQYGHVWI EFMPNDEGAG FEFVDNIVGG VVPREYIGSV       540
     EAGVKDALDN GLLAGYPLVD VKARLYDGSY HDVDSNEMAF KVAASMALKE AKKKCNPVLL       600
     EPIMKVEVVI PEEYMGDIMG DVTSRRGRVE GMEARGNAQI VKAMVPLSEM FGYATSLRSN       660
     TQGRGNYSMH FDHYEEVPKS ISEEIIKKQG GE                                     692
//

If you have problems or comments...

PBIL Back to PBIL home page