(data stored in ACNUC7421 zone)

EMBL: CP001791.PE110

CP001791.PE110       Location/Qualifiers
FT   CDS             138028..138849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97662"
FT                   /db_xref="GOA:D6XVN9"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97662.1"
FT                   /translation="MGIHDYYKQAGRAYFYLAAVSGLLFVVFFLLYFVLDQGPLAGLDG
FT                   LILLGVMAVGFLITGFVKRNRSVTPYPKGAVADSDHDLHSVSRVVIAPLVHLLREYQIF
FT                   SLDGKKIAEVRDVVTGWRRYRSFILELMGIRMFFPKTMEVATEDGVIYRLEKYGGFHEV
FT                   YELYTIEGTQIASFRMNVWNPFRTYATIHDRDGKQIGENDGGLSGQRFIVKDQEGNRLV
FT                   ELKHQGIPMEALELFSGVNGDLVDISQDRIDEELRPVFIMAPILVKLHFRK"
     MGIHDYYKQA GRAYFYLAAV SGLLFVVFFL LYFVLDQGPL AGLDGLILLG VMAVGFLITG        60
     FVKRNRSVTP YPKGAVADSD HDLHSVSRVV IAPLVHLLRE YQIFSLDGKK IAEVRDVVTG       120
     WRRYRSFILE LMGIRMFFPK TMEVATEDGV IYRLEKYGGF HEVYELYTIE GTQIASFRMN       180
     VWNPFRTYAT IHDRDGKQIG ENDGGLSGQR FIVKDQEGNR LVELKHQGIP MEALELFSGV       240
     NGDLVDISQD RIDEELRPVF IMAPILVKLH FRK                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page