(data stored in ACNUC7421 zone)

EMBL: CP001791.PE111

CP001791.PE111       Location/Qualifiers
FT   CDS             139115..139423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0114"
FT                   /product="ribosomal protein S10"
FT                   /note="KEGG: ank:AnaeK_1933 30S ribosomal protein S10;
FT                   TIGRFAM: ribosomal protein S10; PFAM: ribosomal protein
FT                   S10"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97663"
FT                   /db_xref="GOA:D6XVP0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP0"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ADH97663.1"
FT                   /translation="MAKQKIRIRLKAYEHRVLDQSAEKIVETAKRSGASVAGPIPLPTE
FT                   KTVYTVLRAVHKYKDSREQFEMRTHKRLIDIVEPTPQTVDALMRLDLPSGVDIEIKL"
     MAKQKIRIRL KAYEHRVLDQ SAEKIVETAK RSGASVAGPI PLPTEKTVYT VLRAVHKYKD        60
     SREQFEMRTH KRLIDIVEPT PQTVDALMRL DLPSGVDIEI KL                          102
//

If you have problems or comments...

PBIL Back to PBIL home page