(data stored in ACNUC7421 zone)

EMBL: CP001791.PE112

CP001791.PE112       Location/Qualifiers
FT   CDS             139469..140095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0115"
FT                   /product="50S ribosomal protein L3"
FT                   /note="KEGG: glo:Glov_1346 50S ribosomal protein L3;
FT                   TIGRFAM: 50S ribosomal protein L3; PFAM: ribosomal protein
FT                   L3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97664"
FT                   /db_xref="GOA:D6XVP1"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP1"
FT                   /inference="protein motif:TFAM:TIGR03625"
FT                   /protein_id="ADH97664.1"
FT                   /translation="MTKGILGKKLGMTQIFSENGEQVPVTVIEASPNVVLQKKTAEGEG
FT                   YEAIQIGYDDKKANRQNSPEKGHAEKAKTAPKRFVKEIRDVNTADYEIGQEIKVDIFAE
FT                   GDAIDVTGTSKGKGFQGAIKRHNQSRGPMSHGSRYHRRPGSMGPVDPNHVRPGKLLPGQ
FT                   MGGETVTIQNLEVVKVDTERNVILVKGNVPGARKSFVTITSATKA"
     MTKGILGKKL GMTQIFSENG EQVPVTVIEA SPNVVLQKKT AEGEGYEAIQ IGYDDKKANR        60
     QNSPEKGHAE KAKTAPKRFV KEIRDVNTAD YEIGQEIKVD IFAEGDAIDV TGTSKGKGFQ       120
     GAIKRHNQSR GPMSHGSRYH RRPGSMGPVD PNHVRPGKLL PGQMGGETVT IQNLEVVKVD       180
     TERNVILVKG NVPGARKSFV TITSATKA                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page