(data stored in ACNUC7421 zone)

EMBL: CP001791.PE113

CP001791.PE113       Location/Qualifiers
FT   CDS             140123..140746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0116"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: sat:SYN_00986
FT                   50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97665"
FT                   /db_xref="GOA:D6XVP2"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP2"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ADH97665.1"
FT                   /translation="MPKVNLYNQTGSQAGDIELNDAVFGIEPNESVVYDAIIMQQASMR
FT                   QGTHAVKGRSDVRGGGRKPWRQKGTGRARHGTNRSPIWVGGGVVFGPTPRSYAYNMPKK
FT                   QRRLALKSALSSKVNEDAIYVMEGLSFDAPKTKEMKKVLEALSAGKKVLVVTADYEDNV
FT                   ALSARNLPNVKFVTAEGVNVLDLVNFESLVITQDAVKQVEEVLA"
     MPKVNLYNQT GSQAGDIELN DAVFGIEPNE SVVYDAIIMQ QASMRQGTHA VKGRSDVRGG        60
     GRKPWRQKGT GRARHGTNRS PIWVGGGVVF GPTPRSYAYN MPKKQRRLAL KSALSSKVNE       120
     DAIYVMEGLS FDAPKTKEMK KVLEALSAGK KVLVVTADYE DNVALSARNL PNVKFVTAEG       180
     VNVLDLVNFE SLVITQDAVK QVEEVLA                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page