(data stored in ACNUC7421 zone)

EMBL: CP001791.PE115

CP001791.PE115       Location/Qualifiers
FT   CDS             141067..141897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0118"
FT                   /product="ribosomal protein L2"
FT                   /note="KEGG: glo:Glov_1349 50S ribosomal protein L2;
FT                   TIGRFAM: ribosomal protein L2; PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97667"
FT                   /db_xref="GOA:D6XVP4"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP4"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADH97667.1"
FT                   /translation="MAIKKYKPTTNGRRGMSVLDFQEITTDKPEKSLLAPIHKRGGRNN
FT                   QGKLTVRHQGGGHKRQYRVIDFKRDKDGIPGRVATIEYDPNRTANIALINYADGEKRYI
FT                   LAAKNMKVGQEIMSGKDADIKMGNALQLKDIPVGTIIHNIELRPGKGGQLVRSAGADAQ
FT                   VLGKEGNYVLVRLRSGETRLILATCRATIGQVGNIEHELVTIGKAGRSRWLGKRPTVRG
FT                   SVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLGYKTRSKNKESNKYIVRRRKK"
     MAIKKYKPTT NGRRGMSVLD FQEITTDKPE KSLLAPIHKR GGRNNQGKLT VRHQGGGHKR        60
     QYRVIDFKRD KDGIPGRVAT IEYDPNRTAN IALINYADGE KRYILAAKNM KVGQEIMSGK       120
     DADIKMGNAL QLKDIPVGTI IHNIELRPGK GGQLVRSAGA DAQVLGKEGN YVLVRLRSGE       180
     TRLILATCRA TIGQVGNIEH ELVTIGKAGR SRWLGKRPTV RGSVMNPNDH PHGGGEGRAP       240
     IGRKSPMSPW GKPTLGYKTR SKNKESNKYI VRRRKK                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page