(data stored in ACNUC7421 zone)

EMBL: CP001791.PE119

CP001791.PE119       Location/Qualifiers
FT   CDS             143265..143699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0122"
FT                   /product="ribosomal protein L16"
FT                   /note="KEGG: gsu:GSU2850 50S ribosomal protein L16;
FT                   TIGRFAM: ribosomal protein L16; PFAM: Ribosomal protein
FT                   L10e/L16"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97671"
FT                   /db_xref="GOA:D6XVP8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP8"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ADH97671.1"
FT                   /translation="MLMPKRVKFRREHRGKMRGRAKGGKEIAFGEYGLQALEASWITNR
FT                   QIESARIAMTRYMKRGGKVWIKIFPDKPYTSKPLEVRMGSGKGAPEGWVAVVKPGKIMF
FT                   EIAGVSEEVAREALRLASHKLPVRTKFVKREEVGGDANES"
     MLMPKRVKFR REHRGKMRGR AKGGKEIAFG EYGLQALEAS WITNRQIESA RIAMTRYMKR        60
     GGKVWIKIFP DKPYTSKPLE VRMGSGKGAP EGWVAVVKPG KIMFEIAGVS EEVAREALRL       120
     ASHKLPVRTK FVKREEVGGD ANES                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page