(data stored in ACNUC7421 zone)

EMBL: CP001791.PE12

CP001791.PE12        Location/Qualifiers
FT   CDS             21160..22047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0013"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="KEGG: apa:APP7_0616 pyridoxal biosynthesis lyase
FT                   PdxS; TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97564"
FT                   /db_xref="GOA:D6XV06"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV06"
FT                   /inference="protein motif:TFAM:TIGR00343"
FT                   /protein_id="ADH97564.1"
FT                   /translation="MEKQVGTDRVKRGMAEMQKGGVIMDVVNAEQAKIAEEAGAVAVMA
FT                   LERVPSDIRAAGGVARMADLTIVEEVQKAVSIPVMAKARIGHIVEARVLESMGVDYIDE
FT                   SEVLTPADEVFHLNKRDYTVPFVCGARNLGEASRRIGEGASMLRTKGEPGTGNIVEAVR
FT                   HQRLIQAQINKVVHMSEDELMTEAKNLGAPYEVLLEIKRNGRLPLVNFAAGGIATPADA
FT                   ALMMHLGSDGVFVGSGIFKSEDPAKFAKAIVEATTHYDDFKLIAEVSKGLGSAMPGLEI
FT                   SSLEDKDRMQERGW"
     MEKQVGTDRV KRGMAEMQKG GVIMDVVNAE QAKIAEEAGA VAVMALERVP SDIRAAGGVA        60
     RMADLTIVEE VQKAVSIPVM AKARIGHIVE ARVLESMGVD YIDESEVLTP ADEVFHLNKR       120
     DYTVPFVCGA RNLGEASRRI GEGASMLRTK GEPGTGNIVE AVRHQRLIQA QINKVVHMSE       180
     DELMTEAKNL GAPYEVLLEI KRNGRLPLVN FAAGGIATPA DAALMMHLGS DGVFVGSGIF       240
     KSEDPAKFAK AIVEATTHYD DFKLIAEVSK GLGSAMPGLE ISSLEDKDRM QERGW            295
//

If you have problems or comments...

PBIL Back to PBIL home page