(data stored in ACNUC7421 zone)

EMBL: CP001791.PE120

CP001791.PE120       Location/Qualifiers
FT   CDS             143689..143892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0123"
FT                   /product="ribosomal protein L29"
FT                   /note="KEGG: pca:Pcar_0709 ribosomal protein L29; TIGRFAM:
FT                   ribosomal protein L29; PFAM: ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97672"
FT                   /db_xref="GOA:D6XVP9"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP9"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ADH97672.1"
FT                   /translation="MKANDIRNLTTAEIEQKSKSLKEELFNLRFQLATGQLDNPARIRE
FT                   VKRSIARAKTVLRERELGITNE"
     MKANDIRNLT TAEIEQKSKS LKEELFNLRF QLATGQLDNP ARIREVKRSI ARAKTVLRER        60
     ELGITNE                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page