(data stored in ACNUC7421 zone)

EMBL: CP001791.PE121

CP001791.PE121       Location/Qualifiers
FT   CDS             143914..144174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0124"
FT                   /product="30S ribosomal protein S17"
FT                   /note="KEGG: prw:PsycPRwf_0435 ribosomal protein S17;
FT                   TIGRFAM: 30S ribosomal protein S17; PFAM: ribosomal protein
FT                   S17"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97673"
FT                   /db_xref="GOA:D6XVQ0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ0"
FT                   /inference="protein motif:TFAM:TIGR03635"
FT                   /protein_id="ADH97673.1"
FT                   /translation="MERNNRKSYVGRVTSDKMDKTITVVVETYKMHPLYGKRVRYSKKL
FT                   KAHDENNTAKKNDVVRIMETKPLSKDKRFRLVEVLEEAVIV"
     MERNNRKSYV GRVTSDKMDK TITVVVETYK MHPLYGKRVR YSKKLKAHDE NNTAKKNDVV        60
     RIMETKPLSK DKRFRLVEVL EEAVIV                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page