(data stored in ACNUC7421 zone)

EMBL: CP001791.PE123

CP001791.PE123       Location/Qualifiers
FT   CDS             144623..144949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0126"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: rfe:RF_0289 50S ribosomal protein L24;
FT                   SMART: KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97675"
FT                   /db_xref="GOA:D6XVQ2"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ2"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ADH97675.1"
FT                   /translation="MKQPTLHVKKGDNVKVISGKDKGKEGKILEAYPSQSRVLVEGVNM
FT                   VKKHAKPSQANPQGGILTQEAAIHVSNVMPIDPKTGEPTRVGYKEENGKKVRIAKKSGE
FT                   SLDN"
     MKQPTLHVKK GDNVKVISGK DKGKEGKILE AYPSQSRVLV EGVNMVKKHA KPSQANPQGG        60
     ILTQEAAIHV SNVMPIDPKT GEPTRVGYKE ENGKKVRIAK KSGESLDN                    108
//

If you have problems or comments...

PBIL Back to PBIL home page