(data stored in ACNUC7421 zone)

EMBL: CP001791.PE124

CP001791.PE124       Location/Qualifiers
FT   CDS             144981..145520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0127"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: gur:Gura_1078 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97676"
FT                   /db_xref="GOA:D6XVQ3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ3"
FT                   /inference="protein motif:PFAM:PF00281"
FT                   /protein_id="ADH97676.1"
FT                   /translation="MSRLKEKFNTEITPSLKEKFNYSSVMEVPRVDKIVVNMGVGDAVQ
FT                   NSKVLDKAVEELAQITGQKPLITKAKKSIAGFKLREGMPIGAKVTLRGERMYDFLDKLI
FT                   AVSLPRVRDFRGVSKKAFDGRGNYTMGVKEQLIFPEINYDDVDQVRGMDIVIVTTADSD
FT                   EEARELLTQMGMPFQK"
     MSRLKEKFNT EITPSLKEKF NYSSVMEVPR VDKIVVNMGV GDAVQNSKVL DKAVEELAQI        60
     TGQKPLITKA KKSIAGFKLR EGMPIGAKVT LRGERMYDFL DKLIAVSLPR VRDFRGVSKK       120
     AFDGRGNYTM GVKEQLIFPE INYDDVDQVR GMDIVIVTTA DSDEEARELL TQMGMPFQK        179
//

If you have problems or comments...

PBIL Back to PBIL home page