(data stored in ACNUC7421 zone)

EMBL: CP001791.PE127

CP001791.PE127       Location/Qualifiers
FT   CDS             146195..146731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0130"
FT                   /product="ribosomal protein L6"
FT                   /note="KEGG: bbt:BBta_5055 50S ribosomal protein L6;
FT                   TIGRFAM: ribosomal protein L6; PFAM: Ribosomal protein L6,
FT                   alpha-beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97679"
FT                   /db_xref="GOA:D6XVQ6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ6"
FT                   /inference="protein motif:TFAM:TIGR03654"
FT                   /protein_id="ADH97679.1"
FT                   /translation="MSRIGLKPVEIPSGVEVKLDGNVMTVKGPKGELSRELHADMEVTV
FT                   EDAQVTVARPSDHKDHRALHGTTRSMINNMVEGVSKGFEKKLELVGVGYRAQKSGKKLI
FT                   LNVGLSHQVEFEDGENIEIEVPNNTNITVKGIDKEAVGALASNIRATRKPEPYKGKGIR
FT                   YEGEYVRRKEGKTGK"
     MSRIGLKPVE IPSGVEVKLD GNVMTVKGPK GELSRELHAD MEVTVEDAQV TVARPSDHKD        60
     HRALHGTTRS MINNMVEGVS KGFEKKLELV GVGYRAQKSG KKLILNVGLS HQVEFEDGEN       120
     IEIEVPNNTN ITVKGIDKEA VGALASNIRA TRKPEPYKGK GIRYEGEYVR RKEGKTGK         178
//

If you have problems or comments...

PBIL Back to PBIL home page