(data stored in ACNUC7421 zone)

EMBL: CP001791.PE128

CP001791.PE128       Location/Qualifiers
FT   CDS             146765..147127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0131"
FT                   /product="ribosomal protein L18"
FT                   /note="KEGG: dat:HRM2_36100 RplR; TIGRFAM: ribosomal
FT                   protein L18; PFAM: ribosomal protein L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97680"
FT                   /db_xref="GOA:D6XVQ7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ7"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ADH97680.1"
FT                   /translation="MITKTDKNAVRKKRHAHVRRSITGTAERPRLNVFRSNNHIYAQLI
FT                   DDVAGVTLASASTVDKELNIEKGGNKEAARKVGELVAKRALDKGYESIVFDRGGYLYHG
FT                   RVKELADGAREAGLKF"
     MITKTDKNAV RKKRHAHVRR SITGTAERPR LNVFRSNNHI YAQLIDDVAG VTLASASTVD        60
     KELNIEKGGN KEAARKVGEL VAKRALDKGY ESIVFDRGGY LYHGRVKELA DGAREAGLKF       120
//

If you have problems or comments...

PBIL Back to PBIL home page