(data stored in ACNUC7421 zone)

EMBL: CP001791.PE129

CP001791.PE129       Location/Qualifiers
FT   CDS             147153..147650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0132"
FT                   /product="ribosomal protein S5"
FT                   /note="KEGG: pca:Pcar_0718 30S ribosomal protein S5;
FT                   TIGRFAM: ribosomal protein S5; PFAM: Ribosomal protein S5;
FT                   ribosomal protein S5 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97681"
FT                   /db_xref="GOA:D6XVQ8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ8"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ADH97681.1"
FT                   /translation="MRIDPTKLEIEERVVTVNRVAKVVKGGRRFRFAALVVVGDKNGHV
FT                   GFGMGKALEVPEAIRKAIEDGKKNMIQVPIQGTTIPHQITGKFGAGSVLLKPASEGTGV
FT                   IAGGPVRAVLELAGIGDILSKSLGSNNPINMVRATIQGLDEMKSPEEVAKLRGKSVEEL
FT                   LG"
     MRIDPTKLEI EERVVTVNRV AKVVKGGRRF RFAALVVVGD KNGHVGFGMG KALEVPEAIR        60
     KAIEDGKKNM IQVPIQGTTI PHQITGKFGA GSVLLKPASE GTGVIAGGPV RAVLELAGIG       120
     DILSKSLGSN NPINMVRATI QGLDEMKSPE EVAKLRGKSV EELLG                       165
//

If you have problems or comments...

PBIL Back to PBIL home page