(data stored in ACNUC7421 zone)

EMBL: CP001791.PE13

CP001791.PE13        Location/Qualifiers
FT   CDS             22066..22659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0014"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG:
FT                   dds:Ddes_1897 SNO glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97565"
FT                   /db_xref="GOA:D6XV07"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV07"
FT                   /inference="protein motif:PFAM:PF01174"
FT                   /protein_id="ADH97565.1"
FT                   /translation="MIKIGVLALQGAVREHVKALQAPDVDVITIKRKEQLAGIDGLVFP
FT                   GGESTTMRRLINQYGFYEPLKAFAAKGKPIFGTCAGAILMASEIANQDDPHLAVMDMTV
FT                   ERNAFGRQKESFEVMLNMKDVAPDIEAVFIRAPIIQSVGPDVDVLAEYDGQIVAARQGP
FT                   FLACSFHPELTDDDRMHQYFVTLVRDAVQTVNNV"
     MIKIGVLALQ GAVREHVKAL QAPDVDVITI KRKEQLAGID GLVFPGGEST TMRRLINQYG        60
     FYEPLKAFAA KGKPIFGTCA GAILMASEIA NQDDPHLAVM DMTVERNAFG RQKESFEVML       120
     NMKDVAPDIE AVFIRAPIIQ SVGPDVDVLA EYDGQIVAAR QGPFLACSFH PELTDDDRMH       180
     QYFVTLVRDA VQTVNNV                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page