(data stored in ACNUC7421 zone)

EMBL: CP001791.PE131

CP001791.PE131       Location/Qualifiers
FT   CDS             147881..148324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0134"
FT                   /product="ribosomal protein L15"
FT                   /note="KEGG: pca:Pcar_0720 ribosomal protein L15; TIGRFAM:
FT                   ribosomal protein L15; PFAM: ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97683"
FT                   /db_xref="GOA:D6XVR0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVR0"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ADH97683.1"
FT                   /translation="MKLHELKPAAGSRNKTRNRVGRGIGSGNGKTAGRGHKGQNARSGG
FT                   GVRPGFEGGQMPIFRRLPKRGFKNPNRVEYAIVNLDTLNRFEDGTEVTPELLVETGTVK
FT                   NERGGIKILGNGTLERKVTVKAHKFSSTAKEAIEAAGGTAEVL"
     MKLHELKPAA GSRNKTRNRV GRGIGSGNGK TAGRGHKGQN ARSGGGVRPG FEGGQMPIFR        60
     RLPKRGFKNP NRVEYAIVNL DTLNRFEDGT EVTPELLVET GTVKNERGGI KILGNGTLER       120
     KVTVKAHKFS STAKEAIEAA GGTAEVL                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page