(data stored in ACNUC7421 zone)

EMBL: CP001791.PE133

CP001791.PE133       Location/Qualifiers
FT   CDS             149363..150112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0136"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="KEGG: pca:Pcar_0723 methionine aminopeptidase, type
FT                   I; TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97685"
FT                   /db_xref="GOA:D6XVR2"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVR2"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ADH97685.1"
FT                   /translation="MIICKTPRELDIMRHAGKIVALTHQELQKHIAPGITTMELDQIAD
FT                   RFIRDHDAIPSFKGYGGFTGSICASVNEELVHGIPGERVLEDGDIISIDIGAKYQGYHG
FT                   DSAWTYPVGTIDAASQKLLDVTENSLFKGLEHAAPGARLSDISHAIQAYVEDNGFSVVR
FT                   EYVGHGVGQELHEDPQIPHFGPPGKGPRLKKGMVLAVEPMINAGKRHVKTLSDNWTVVT
FT                   SDGERCAHFEHTIAIVDKGYEILTKAD"
     MIICKTPREL DIMRHAGKIV ALTHQELQKH IAPGITTMEL DQIADRFIRD HDAIPSFKGY        60
     GGFTGSICAS VNEELVHGIP GERVLEDGDI ISIDIGAKYQ GYHGDSAWTY PVGTIDAASQ       120
     KLLDVTENSL FKGLEHAAPG ARLSDISHAI QAYVEDNGFS VVREYVGHGV GQELHEDPQI       180
     PHFGPPGKGP RLKKGMVLAV EPMINAGKRH VKTLSDNWTV VTSDGERCAH FEHTIAIVDK       240
     GYEILTKAD                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page