(data stored in ACNUC7421 zone)

EMBL: CP001791.PE134

CP001791.PE134       Location/Qualifiers
FT   CDS             150137..150439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97686"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97686.1"
FT                   /translation="MKDPESDVQVGELVRILNGRDKDQFACVIEVLDERFVLIADGDKR
FT                   KVDRAKRKNISHIEPMKIVVPEVRNSIDDTGRVTNAKLRFAISSYLEDHLLKKGE"
     MKDPESDVQV GELVRILNGR DKDQFACVIE VLDERFVLIA DGDKRKVDRA KRKNISHIEP        60
     MKIVVPEVRN SIDDTGRVTN AKLRFAISSY LEDHLLKKGE                             100
//

If you have problems or comments...

PBIL Back to PBIL home page