(data stored in ACNUC7421 zone)

EMBL: CP001791.PE137

CP001791.PE137       Location/Qualifiers
FT   CDS             150847..151212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0140"
FT                   /product="30S ribosomal protein S13"
FT                   /note="KEGG: gme:Gmet_0650 30S ribosomal protein S13;
FT                   TIGRFAM: 30S ribosomal protein S13; PFAM: ribosomal protein
FT                   S13"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97689"
FT                   /db_xref="GOA:D6XVR6"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVR6"
FT                   /inference="protein motif:TFAM:TIGR03631"
FT                   /protein_id="ADH97689.1"
FT                   /translation="MARVAGVDIPRDKRVVVSLTYVFGIGRSKAAQILTEAGVSENTRV
FT                   RDLTEDELAKIREVVDGVKVEGDLRREVSLNIKRLIEIGSYRGIRHRRGLPVRGQKTKN
FT                   NARTRKGPRRTVANKKK"
     MARVAGVDIP RDKRVVVSLT YVFGIGRSKA AQILTEAGVS ENTRVRDLTE DELAKIREVV        60
     DGVKVEGDLR REVSLNIKRL IEIGSYRGIR HRRGLPVRGQ KTKNNARTRK GPRRTVANKK       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page