(data stored in ACNUC7421 zone)

EMBL: CP001791.PE14

CP001791.PE14        Location/Qualifiers
FT   CDS             22972..24246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0015"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; KEGG: gme:Gmet_3528
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97566"
FT                   /db_xref="GOA:D6XV08"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV08"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADH97566.1"
FT                   /translation="MLDMKRLRADFEGVREKLATRNEDISALDDFQKLDEERRQVIQKV
FT                   EELKGKRNTVSEEISKMKRNKEDASDVIAEMKDVSAEIKALDEKQRDVDEKMKTLMLSI
FT                   PNIPHESAPVGLDETENEEIRTWGERPAFDFEGKAHWDLAVTHDIVDFERASKITGSRF
FT                   AIYKGAGARLERALMNFMMDFHEDKHGYTEVLPPYMVNRDSMTGTGQLPKFEEDAFQIR
FT                   EEDYFLIPTAEVPVTNMHRDEILTADELPIAYSAFSACFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVRFVKPEDSYAELEKLTGHAEKILQQLNLPYRVLNMCTGDLGFTAAKKYDIEVW
FT                   LPSYGEYKEISSCSNFEDFQARRANIRFKRDQKGKAEFVHTLNGSGLAIGRTVAAILEN
FT                   YQQADGTIKIPKVLQPYMGGKTRIG"
     MLDMKRLRAD FEGVREKLAT RNEDISALDD FQKLDEERRQ VIQKVEELKG KRNTVSEEIS        60
     KMKRNKEDAS DVIAEMKDVS AEIKALDEKQ RDVDEKMKTL MLSIPNIPHE SAPVGLDETE       120
     NEEIRTWGER PAFDFEGKAH WDLAVTHDIV DFERASKITG SRFAIYKGAG ARLERALMNF       180
     MMDFHEDKHG YTEVLPPYMV NRDSMTGTGQ LPKFEEDAFQ IREEDYFLIP TAEVPVTNMH       240
     RDEILTADEL PIAYSAFSAC FRSEAGSAGR DTRGLIRQHQ FNKVELVRFV KPEDSYAELE       300
     KLTGHAEKIL QQLNLPYRVL NMCTGDLGFT AAKKYDIEVW LPSYGEYKEI SSCSNFEDFQ       360
     ARRANIRFKR DQKGKAEFVH TLNGSGLAIG RTVAAILENY QQADGTIKIP KVLQPYMGGK       420
     TRIG                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page