(data stored in ACNUC7421 zone)

EMBL: CP001791.PE145

CP001791.PE145       Location/Qualifiers
FT   CDS             156749..157186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0148"
FT                   /product="ribosomal protein L13"
FT                   /note="KEGG: mmw:Mmwyl1_2400 50S ribosomal protein L13;
FT                   TIGRFAM: ribosomal protein L13; PFAM: ribosomal protein
FT                   L13"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97697"
FT                   /db_xref="GOA:D6XVS4"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVS4"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADH97697.1"
FT                   /translation="MRTTYMAKGHEVERKWYVVDAEGQTLGRLSSEVASILRGKHKPTF
FT                   TPHVDTGDHVIIINAEKIHLTGNKLMDKKYYRHSRYPGSLKTTTAGEMRANKPERLLEL
FT                   SIKGMMPKGSLGRQMTKKLNVYAGPEHPHAAQKPEAYELRG"
     MRTTYMAKGH EVERKWYVVD AEGQTLGRLS SEVASILRGK HKPTFTPHVD TGDHVIIINA        60
     EKIHLTGNKL MDKKYYRHSR YPGSLKTTTA GEMRANKPER LLELSIKGMM PKGSLGRQMT       120
     KKLNVYAGPE HPHAAQKPEA YELRG                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page