(data stored in ACNUC7421 zone)

EMBL: CP001791.PE147

CP001791.PE147       Location/Qualifiers
FT   CDS             158250..159518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0150"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: neu:NE2190 integron/retron-type RNA-directed
FT                   DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97699"
FT                   /db_xref="GOA:D6XVS6"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVS6"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /protein_id="ADH97699.1"
FT                   /translation="MQLIDRVVCPDNLNLAMNRVISNKGNPGVDGMTVDQLEAHVRQYA
FT                   KPLIAKIQKGTYQPLPVKRVEIPKENGKKRKLGIPAVRDRMVQQAIFQVIEPIIDPHFS
FT                   PNSYGFRPGKNAKQAIKQAAKYYDEGFKMVVDIDLKSYFDTIPHQKLMNYLEQYIQDPI
FT                   ILKLIWKFLKSGIMIGDNWESSRNGAPQGGNLSPILSNVYLHELDKELERRGHRFVRYA
FT                   DDFCIYVKSRRAAERVLLNTTTFLEGTLKLSVNQEKSAIGSPTKRKFLGFCIHKSNNET
FT                   RCRPHHASKAKFKAKLKYLTRRNQANSFDYIILKINQVTTGWINYYGISYMKSFINSIK
FT                   QWLHHRLRQLIWKQWKKIKTRYKNLMKYGIETEEAWKMANTRKGYWRASKNETLHKAIK
FT                   IEKLAGWGLKDMSQLYEHAYSTY"
     MQLIDRVVCP DNLNLAMNRV ISNKGNPGVD GMTVDQLEAH VRQYAKPLIA KIQKGTYQPL        60
     PVKRVEIPKE NGKKRKLGIP AVRDRMVQQA IFQVIEPIID PHFSPNSYGF RPGKNAKQAI       120
     KQAAKYYDEG FKMVVDIDLK SYFDTIPHQK LMNYLEQYIQ DPIILKLIWK FLKSGIMIGD       180
     NWESSRNGAP QGGNLSPILS NVYLHELDKE LERRGHRFVR YADDFCIYVK SRRAAERVLL       240
     NTTTFLEGTL KLSVNQEKSA IGSPTKRKFL GFCIHKSNNE TRCRPHHASK AKFKAKLKYL       300
     TRRNQANSFD YIILKINQVT TGWINYYGIS YMKSFINSIK QWLHHRLRQL IWKQWKKIKT       360
     RYKNLMKYGI ETEEAWKMAN TRKGYWRASK NETLHKAIKI EKLAGWGLKD MSQLYEHAYS       420
     TY                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page