(data stored in ACNUC7421 zone)

EMBL: CP001791.PE15

CP001791.PE15        Location/Qualifiers
FT   CDS             24835..25848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0016"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: dde:Dde_1182 oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97567"
FT                   /db_xref="GOA:D6XV09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV09"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADH97567.1"
FT                   /translation="MSNQDALLEIKDLHTGFTIDGKMHYAVKDVSFSVKPREVVCVVGE
FT                   SGCGKSVMSLSVMKLLPKHNGTIDKGQILYKGRDLVPLNDKEMNKIRGKDISMIFQEPM
FT                   TALNPVMTIGWQMDEVLHNHTDNSREEIRKKSISLLKQVGISRGEQIVNEYPHQLSGGM
FT                   RQRVMIAMAIACQPQLLIADEPTTALDVTVQAQILELITKIQDEVGMAVMLITHDLGVV
FT                   AEMADRVVVMYAGQVVEESDVDRIFYDPKHPYTKALLSSIPRMDEDREVLNTIKGIVPS
FT                   LKNMPEKGCRFVNRCPEAMPECSEIDPELGETEKGHSVRCILYDASKPGASTEVQQ"
     MSNQDALLEI KDLHTGFTID GKMHYAVKDV SFSVKPREVV CVVGESGCGK SVMSLSVMKL        60
     LPKHNGTIDK GQILYKGRDL VPLNDKEMNK IRGKDISMIF QEPMTALNPV MTIGWQMDEV       120
     LHNHTDNSRE EIRKKSISLL KQVGISRGEQ IVNEYPHQLS GGMRQRVMIA MAIACQPQLL       180
     IADEPTTALD VTVQAQILEL ITKIQDEVGM AVMLITHDLG VVAEMADRVV VMYAGQVVEE       240
     SDVDRIFYDP KHPYTKALLS SIPRMDEDRE VLNTIKGIVP SLKNMPEKGC RFVNRCPEAM       300
     PECSEIDPEL GETEKGHSVR CILYDASKPG ASTEVQQ                                337
//

If you have problems or comments...

PBIL Back to PBIL home page