(data stored in ACNUC7421 zone)

EMBL: CP001791.PE155

CP001791.PE155       Location/Qualifiers
FT   CDS             168489..169169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0158"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: lhk:LHK_01309
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97707"
FT                   /db_xref="GOA:D6XVT4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT4"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADH97707.1"
FT                   /translation="MTHVQAQAKPYEFTFDPKTTALVLIDMQRDFVAPGGFGEKLGNDI
FT                   SATRAIIPATQEMLEAAREAGMMVIHTREGHRTDLSDCPPSKLNRGKKQGAGIGDVGPM
FT                   GRILVRGEYGHDLVDELKPVEGEVVIDKPGKGAFYMTDLESVLLNRGITHLLVGGVTTH
FT                   VCVQSTIREANDRGFDCLLLEDCSAAFDPKDHEDSIRMIHQQGGIFGWTSTSDEVKKAL
FT                   ASRN"
     MTHVQAQAKP YEFTFDPKTT ALVLIDMQRD FVAPGGFGEK LGNDISATRA IIPATQEMLE        60
     AAREAGMMVI HTREGHRTDL SDCPPSKLNR GKKQGAGIGD VGPMGRILVR GEYGHDLVDE       120
     LKPVEGEVVI DKPGKGAFYM TDLESVLLNR GITHLLVGGV TTHVCVQSTI REANDRGFDC       180
     LLLEDCSAAF DPKDHEDSIR MIHQQGGIFG WTSTSDEVKK ALASRN                      226
//

If you have problems or comments...

PBIL Back to PBIL home page