(data stored in ACNUC7421 zone)

EMBL: CP001791.PE156

CP001791.PE156       Location/Qualifiers
FT   CDS             169199..170761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0159"
FT                   /product="xanthine/uracil/vitamin C permease"
FT                   /note="KEGG: lhk:LHK_01305 xanthine/uracil/vitamin C
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97708"
FT                   /db_xref="GOA:D6XVT5"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT5"
FT                   /inference="similar to AA sequence:KEGG:LHK_01305"
FT                   /protein_id="ADH97708.1"
FT                   /translation="MSEQKGKGVAWFTKGDLNGFFGLFTNVLTNFLAAIGLLVFAINMP
FT                   GEIVYGRIVPAAALSIGIGSIIFAIQAKRLSEREGRTNVTALPYGLSVPHYFVVAFAVM
FT                   LPVYAMSGDWMLAWAVGIAWNVVQGIIMTIGAFIGPFIRKYIPRAAMLASLAGIALTYI
FT                   AMNPAGEVYTTPYIGLLTLTIVLAGWLAQKSLPFKMPAGLLAIVIGMIIAWSTGYMDVA
FT                   EVQSAAAEFSPALPLLAISMIPQGFAFLAPFLAAAIPLGIYDFLESLDNIESAEADGDK
FT                   YATVPTMLVPASLTLFGAALGSVYPTIIYIGHPGWKKAGARAGYSMATGIGALVVGFLG
FT                   IMPLVLSFIPLVALLPILIYITMVIGAQTFNETPRRHYPALIIALMPFIASYVITQIDN
FT                   ALGAMGTSAAEVGYETLADAGIPYLGWQAFGAADILVAMILATIVIYIIDRNFRYALVY
FT                   ALIAAVLSFFGVIHAPEIGIGQGLNAALGYLSMSVALLAMMFYRPEENRTEDVSALEEL
FT                   DQS"
     MSEQKGKGVA WFTKGDLNGF FGLFTNVLTN FLAAIGLLVF AINMPGEIVY GRIVPAAALS        60
     IGIGSIIFAI QAKRLSEREG RTNVTALPYG LSVPHYFVVA FAVMLPVYAM SGDWMLAWAV       120
     GIAWNVVQGI IMTIGAFIGP FIRKYIPRAA MLASLAGIAL TYIAMNPAGE VYTTPYIGLL       180
     TLTIVLAGWL AQKSLPFKMP AGLLAIVIGM IIAWSTGYMD VAEVQSAAAE FSPALPLLAI       240
     SMIPQGFAFL APFLAAAIPL GIYDFLESLD NIESAEADGD KYATVPTMLV PASLTLFGAA       300
     LGSVYPTIIY IGHPGWKKAG ARAGYSMATG IGALVVGFLG IMPLVLSFIP LVALLPILIY       360
     ITMVIGAQTF NETPRRHYPA LIIALMPFIA SYVITQIDNA LGAMGTSAAE VGYETLADAG       420
     IPYLGWQAFG AADILVAMIL ATIVIYIIDR NFRYALVYAL IAAVLSFFGV IHAPEIGIGQ       480
     GLNAALGYLS MSVALLAMMF YRPEENRTED VSALEELDQS                             520
//

If you have problems or comments...

PBIL Back to PBIL home page