(data stored in ACNUC7421 zone)

EMBL: CP001791.PE159

CP001791.PE159       Location/Qualifiers
FT   CDS             173140..174564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0162"
FT                   /product="protein of unknown function DUF1116"
FT                   /note="PFAM: protein of unknown function DUF1116; KEGG:
FT                   lhk:LHK_01303 DUF1116 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97711"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT8"
FT                   /inference="protein motif:PFAM:PF06545"
FT                   /protein_id="ADH97711.1"
FT                   /translation="MTTTLFQTELKPVNIGTDTFKQDLTKQGLAAVQVDWRPPAGGNLA
FT                   LVKALDGLMDRPDIDEANKKVTAILKSAHPVLVDMQKAIDVIPGMHDKLFLHAGPPIEW
FT                   ARMCGPMQGAIIGAILFEGLADNEADARKLAESGELSFAPCHSHQAVGPMAGVLSPSMP
FT                   VHVVENKEHGNRAYCSINEGLGKVLRYGAFSEEVINRLTWLKESFMPVMQRALQAAKNG
FT                   IDLKALIAQALHMGDEVHNRNKAATSLFIREMLPYLMQDKDHEAMQEALSFMNQNDHYF
FT                   LNLSMPACKASLDAAHGVKNATIVTTMARNGVDFGIRVSGLGEDEWFTAPANYVKGLVF
FT                   PGFKEDDAAPDIGDSTITETMGIGGFTMGGAPAIVQFVGGTVSDAMAYSEQMYQITTDE
FT                   NSNYSIPTLDFRGSPVGIDVRKVIDTNILPIINTGMAHKTAGVGQVGAGLVEPPAACFE
FT                   QALMTLANEKEAVTHE"
     MTTTLFQTEL KPVNIGTDTF KQDLTKQGLA AVQVDWRPPA GGNLALVKAL DGLMDRPDID        60
     EANKKVTAIL KSAHPVLVDM QKAIDVIPGM HDKLFLHAGP PIEWARMCGP MQGAIIGAIL       120
     FEGLADNEAD ARKLAESGEL SFAPCHSHQA VGPMAGVLSP SMPVHVVENK EHGNRAYCSI       180
     NEGLGKVLRY GAFSEEVINR LTWLKESFMP VMQRALQAAK NGIDLKALIA QALHMGDEVH       240
     NRNKAATSLF IREMLPYLMQ DKDHEAMQEA LSFMNQNDHY FLNLSMPACK ASLDAAHGVK       300
     NATIVTTMAR NGVDFGIRVS GLGEDEWFTA PANYVKGLVF PGFKEDDAAP DIGDSTITET       360
     MGIGGFTMGG APAIVQFVGG TVSDAMAYSE QMYQITTDEN SNYSIPTLDF RGSPVGIDVR       420
     KVIDTNILPI INTGMAHKTA GVGQVGAGLV EPPAACFEQA LMTLANEKEA VTHE             474
//

If you have problems or comments...

PBIL Back to PBIL home page