(data stored in ACNUC7421 zone)

EMBL: CP001791.PE16

CP001791.PE16        Location/Qualifiers
FT   CDS             25845..26834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0017"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: bja:blr1357 peptide ABC transporter ATP-binding
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97568"
FT                   /db_xref="GOA:D6XV10"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV10"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADH97568.1"
FT                   /translation="MTKATETSEHLLVVEELKKYYPVRGGFFRRKVGDVKAVDNISLEL
FT                   KRGETFGLVGESGCGKSTAGRTITRLFKPTEGKITFEGRDITDLRGSELRNIRKDIQMV
FT                   FQDPYASLNPKMMVGSIITEPIINFNGGNESKYKEEVMQLLTRVGLPEDAYFKYPHEFS
FT                   GGQRQRIGIARALALKPKLIVADEPVSALDVSVQSQVLNLLKELQEEFNLTLLFIAHDL
FT                   SVVKHMSDRIGVMYLGNLVEIADADEIYANPKHPYTQALISAIPQPDPRNKSERIILSG
FT                   DVPSPQNPPVGCPFHPRCPQVMPECSEKKPELKGVNGEHRVSCLLYEK"
     MTKATETSEH LLVVEELKKY YPVRGGFFRR KVGDVKAVDN ISLELKRGET FGLVGESGCG        60
     KSTAGRTITR LFKPTEGKIT FEGRDITDLR GSELRNIRKD IQMVFQDPYA SLNPKMMVGS       120
     IITEPIINFN GGNESKYKEE VMQLLTRVGL PEDAYFKYPH EFSGGQRQRI GIARALALKP       180
     KLIVADEPVS ALDVSVQSQV LNLLKELQEE FNLTLLFIAH DLSVVKHMSD RIGVMYLGNL       240
     VEIADADEIY ANPKHPYTQA LISAIPQPDP RNKSERIILS GDVPSPQNPP VGCPFHPRCP       300
     QVMPECSEKK PELKGVNGEH RVSCLLYEK                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page