(data stored in ACNUC7421 zone)

EMBL: CP001791.PE161

CP001791.PE161       Location/Qualifiers
FT   CDS             175711..176670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0164"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG:
FT                   oan:Oant_1227 bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97713"
FT                   /db_xref="GOA:D6XVU0"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU0"
FT                   /inference="protein motif:PFAM:PF01758"
FT                   /protein_id="ADH97713.1"
FT                   /translation="METVARISQFFSKYFAVIVITVSLVAFFTPDTFAWIAAYITVLLG
FT                   IVMFGMGTTMRLSDFKVVAQKPLPVLIGLLAQFLVMPLTAFLIATVLGLPPELAAGLVL
FT                   VGACPGGTASNVMVYLSKGDVPVSVAMTSVSTMLAPILTPLAVLLLAGQWLPVSTGDMV
FT                   MSIVEVIIVPIALGLLARRLLPGVVDKGQAALPLVSVTAIMLIVTAVVAVNAENIITSG
FT                   LAVFAAVILHNGFGLFLGYAAAMWAGLDETKRRAISMEVGMQNSGLGAALATAHFSPLA
FT                   ALPSAIFSVWHNISGPLLVSFWNRSNKQPAETKQAVNQ"
     METVARISQF FSKYFAVIVI TVSLVAFFTP DTFAWIAAYI TVLLGIVMFG MGTTMRLSDF        60
     KVVAQKPLPV LIGLLAQFLV MPLTAFLIAT VLGLPPELAA GLVLVGACPG GTASNVMVYL       120
     SKGDVPVSVA MTSVSTMLAP ILTPLAVLLL AGQWLPVSTG DMVMSIVEVI IVPIALGLLA       180
     RRLLPGVVDK GQAALPLVSV TAIMLIVTAV VAVNAENIIT SGLAVFAAVI LHNGFGLFLG       240
     YAAAMWAGLD ETKRRAISME VGMQNSGLGA ALATAHFSPL AALPSAIFSV WHNISGPLLV       300
     SFWNRSNKQP AETKQAVNQ                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page