(data stored in ACNUC7421 zone)

EMBL: CP001791.PE162

CP001791.PE162       Location/Qualifiers
FT   CDS             176910..178595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0165"
FT                   /product="choline dehydrogenase"
FT                   /note="KEGG: dal:Dalk_0705 choline dehydrogenase; TIGRFAM:
FT                   choline dehydrogenase; PFAM: glucose-methanol-choline
FT                   oxidoreductase; FAD dependent oxidoreductase; GMC
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97714"
FT                   /db_xref="GOA:D6XVU1"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU1"
FT                   /inference="protein motif:TFAM:TIGR01810"
FT                   /protein_id="ADH97714.1"
FT                   /translation="MSEKYDVVIIGGGSAGCVMANRLSEDENRSVLVLEAGRKDFSWDL
FT                   LIQMPAALPFPAGKSLYDWKYESDPEPYMGQRRISHARGKVLGGSSSINGMIYQRGNPL
FT                   DYERWGKDPGMENWDFAHCLPYFKRLESALGSDKDDPYRGHDGPLKLERGPAKNPLFQA
FT                   FFDAAVEAGYNRTPDVNGFRQEGFGPFDKHLYKGRRMSASRAYLQPVMKRKNLTVKTRA
FT                   FVSSIDFEGKRAKGVTYKRNGKVHQIEAGEVILAGGAINTPQMLQLSGVGDAQHLRSLG
FT                   IKPVVDLPGVGENLQDHLEAYIQYSCPKPVSEQPNLSLHRMPWIGLQWIFARKGAAATN
FT                   HFEGGGFVRSNDIVDYPNLMFHFLPVAVRYDGTKADTKHGFQVHVGPMYSDARGSLKIT
FT                   SKDPRKHPSMVYNYLSTEQDRREWIEAVRISRNIMAQDAIKPYNSGEIAPGPEVQTDDE
FT                   ILEWVAKDAETALHPSCTAKMGPASDPMAVVDPESMKVHGLENVRVVDASAMPYVTNGN
FT                   IHAPVLMLAEKAADLIRGKKPLEPEHLDFYRHGVHPADAGVEKK"
     MSEKYDVVII GGGSAGCVMA NRLSEDENRS VLVLEAGRKD FSWDLLIQMP AALPFPAGKS        60
     LYDWKYESDP EPYMGQRRIS HARGKVLGGS SSINGMIYQR GNPLDYERWG KDPGMENWDF       120
     AHCLPYFKRL ESALGSDKDD PYRGHDGPLK LERGPAKNPL FQAFFDAAVE AGYNRTPDVN       180
     GFRQEGFGPF DKHLYKGRRM SASRAYLQPV MKRKNLTVKT RAFVSSIDFE GKRAKGVTYK       240
     RNGKVHQIEA GEVILAGGAI NTPQMLQLSG VGDAQHLRSL GIKPVVDLPG VGENLQDHLE       300
     AYIQYSCPKP VSEQPNLSLH RMPWIGLQWI FARKGAAATN HFEGGGFVRS NDIVDYPNLM       360
     FHFLPVAVRY DGTKADTKHG FQVHVGPMYS DARGSLKITS KDPRKHPSMV YNYLSTEQDR       420
     REWIEAVRIS RNIMAQDAIK PYNSGEIAPG PEVQTDDEIL EWVAKDAETA LHPSCTAKMG       480
     PASDPMAVVD PESMKVHGLE NVRVVDASAM PYVTNGNIHA PVLMLAEKAA DLIRGKKPLE       540
     PEHLDFYRHG VHPADAGVEK K                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page